PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang1151s00010.1
Common NameLR48_Vigan530s001000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 269aa    MW: 29349.2 Da    PI: 8.5817
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang1151s00010.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.62.2e-3157111459
       ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        +YkeClkNhA+ +Ggha+DGCgEfm++ g+egt +alkCaAC+CHRnFHR++++e
  Vang1151s00010.1  57 GKYKECLKNHAVGIGGHALDGCGEFMAA-GAEGTLDALKCAACNCHRNFHRKDPSE 111
                       68*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2257112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.4E-2958108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-2858108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.20759108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.88E-19178246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-31178247IPR009057Homeodomain-like
TIGRFAMsTIGR015653.9E-26188244IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDFEEHDEAQ LGMPGPTYDH SSFNPCRVKM PTHIVQEDPL PPAATPPPTI SRNNARGKYK  60
ECLKNHAVGI GGHALDGCGE FMAAGAEGTL DALKCAACNC HRNFHRKDPS ESSFLMPFQH  120
RRHQPPPQFA AAYYRAPAGY LQVAGPHRGG LATLALPSTS GAGGGAQSPR EDQEDVSDPS  180
GGGSGSNKKR FRTKFTLEQK DKMLAFAEKL GWRIQKHDES VVQEFCSQTG VQRHVLKVWM  240
HNNKHTLVTI TATIPSWKLN VEAGKLRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-271892461875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523985.11e-167PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ6YXH54e-71ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A0L9TCU20.0A0A0L9TCU2_PHAAN; Uncharacterized protein
STRINGGLYMA18G21520.21e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-59homeobox protein 22
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]